DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CRISP3

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:150 Identity:45/150 - (30%)
Similarity:69/150 - (46%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEW-----ANYLLSRNRMEHRQNS--------G 56
            |.::|::..||  ..:....|    |..|.|..||     ||.....|:..:|.::        .
Human    68 QVQREIVNKHN--ELRRAVSP----PARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLK 126

  Fly    57 YGENIYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN--TGHFTQVVWKSSTELGVGFA---- 115
            .|||:||:|..: ..:.|::||::|...:::.......|  .||:|||||.||..:|.|.|    
Human   127 CGENLYMSSASS-SWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPN 190

  Fly   116 KSGSTIYVVCNYNPPGNYNN 135
            :.....|.||.|.|.||:.|
Human   191 QKVLKYYYVCQYCPAGNWAN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 38/138 (28%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.