DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and LOC101883528

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:189 Identity:49/189 - (25%)
Similarity:78/189 - (41%) Gaps:55/189 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QQFEQEVL---QAHNLYRAKHGAQP------LTLSPKLNRLATEW--ANYLLSRN-RMEHRQNSG 56
            |..|||:|   ..||..|::  .||      ..:..:..||..|.  |..:...| .:||..   
Zfish    22 QLTEQEILNIVDLHNELRSQ--VQPSAAFMQKVVWDETIRLVAEGYAAKCIWDHNPDLEHLT--- 81

  Fly    57 YGENIYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN--TGHFTQVVWKSSTELG-------- 111
            .|||:::.: |......||..|:.|...||:|:.....:  .||:||:||.::|::|        
Zfish    82 MGENLFVGT-GPFNATKAVMDWFNENLDYNYNTNDCAEDKMCGHYTQLVWANTTKIGCASYFCDT 145

  Fly   112 ---VGFAKSGSTIYVVCNYNPPGNY--------------------NNL-FRENVAPPMQ 146
               :.|.|:   ..::|:|.|.||.                    ||: ..||:.||.:
Zfish   146 LEKLHFEKA---TLLICDYYPQGNIEGQKPYESGESCSKCPEECENNICVMENLFPPFE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 37/144 (26%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 35/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.