powered by:
Protein Alignment CG16995 and CG42717
DIOPT Version :9
Sequence 1: | NP_608668.2 |
Gene: | CG16995 / 33413 |
FlyBaseID: | FBgn0031412 |
Length: | 146 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189115.1 |
Gene: | CG42717 / 10178897 |
FlyBaseID: | FBgn0261634 |
Length: | 96 |
Species: | Drosophila melanogaster |
Alignment Length: | 42 |
Identity: | 10/42 - (23%) |
Similarity: | 16/42 - (38%) |
Gaps: | 10/42 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 GNLKGADAVRS----------WYEEIRQYNWNSPSFQGNTGH 98
|||.|.:..:| |:...|..|....::.|..|:
Fly 38 GNLDGGNNRKSKCKKSANKNMWHYNTRTKNCTQFNYLGCGGN 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.