DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and LOC100536500

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:153 Identity:46/153 - (30%)
Similarity:72/153 - (47%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYL-------LSRNRMEH-----RQNSGY-- 57
            :||::..||.:|  ...||    ...|.|...|::.:       :::..|.|     |..:||  
Zfish    40 QQEIVDVHNAFR--RAVQP----SASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYEM 98

  Fly    58 GENIYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN-TGHFTQVVWKSSTELGVGFAKSGSTI 121
            |||::.|:|.: .....|.:|:.|:..|.:...|..|. |||:|||||.||.|:|....:.||..
Zfish    99 GENLFKATGIS-SWTSVVDAWHSEVNNYKYPIGSINGQATGHYTQVVWYSSYEVGCAVTQCGSNY 162

  Fly   122 YVVCNYNPPGNYNNLFRENVAPP 144
            :..|:|...||:..:      ||
Zfish   163 FYGCHYYRAGNFRTV------PP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 40/132 (30%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.