DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and crispld2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:155 Identity:39/155 - (25%)
Similarity:69/155 - (44%) Gaps:34/155 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QEVLQAHN-----LYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNS---GYGENIYMA 64
            :|:|:.||     :|......:.:....:|.|.||.||    .:.:.||....   ..|:|:.:.
Zfish    62 EEILKLHNKLRGEVYPTASNMEYMIWDDELERSATSWA----EQCQWEHGPQDLLMSIGQNLAVH 122

  Fly    65 SGGNLKGADAVRSWYEEIRQYNWNSPSFQGN-------TG----HFTQVVWKSSTELGVGFAKS- 117
            .|.....|..|::||:|::.|.:..| .:.|       :|    |:||:||.::..:|...... 
Zfish   123 WGRYRSPAYHVQAWYDEVKDYTYPYP-HECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCP 186

  Fly   118 ---------GSTIYVVCNYNPPGNY 133
                     .:.:|:||||:|.||:
Zfish   187 RMNVWGEIWENAVYLVCNYSPKGNW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 32/145 (22%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 35/148 (24%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.