DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and crisp2-like

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:148 Identity:41/148 - (27%)
Similarity:59/148 - (39%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAKHGAQPLTLSPKL-NRLATEW------------ANYLLSRNRMEHRQ-----NSG 56
            ::..|||.|.       ::.|.. :.|..||            |..::..:....||     |..
 Frog    38 LVDLHNLLRR-------SVDPTAKDMLKMEWSPGAALNAQNAAAKCVMQHSSATERQIQDPFNYV 95

  Fly    57 YGENIYMASGGNLKGADAVRSWYEEIRQYNWN-SPSFQGNTGHFTQVVWKSSTELGVGFAKSGST 120
            .|||||:.: .....|.||.||:.|...:.:. .|:.....||:|||.|..:..||.|.|.....
 Frog    96 CGENIYVTT-AKPDWAAAVNSWFNERNDFTYGVGPNSDKMIGHYTQVAWAKTYLLGCGLAFCPGN 159

  Fly   121 IY---VVCNYNPPGNYNN 135
            .|   .:|:|.|.||..|
 Frog   160 YYPYVSICHYCPMGNMIN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 35/136 (26%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 37/140 (26%)
Crisp 189..>205 CDD:312162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.