DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and r3hdml

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:161 Identity:48/161 - (29%)
Similarity:73/161 - (45%) Gaps:38/161 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQQFEQEVLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNS---GY 57
            |||      :|..||..|:|     ...:.:....:|.:.|..|||    :.:.:|..|.   ..
 Frog    63 MSA------LLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWAN----QCKWDHGPNQLMRYI 117

  Fly    58 GENIYMASGGNLKGADAVRSWYEEIRQYNWN-----SPSFQGN-TG----HFTQVVWKSSTELG- 111
            |:|:.:.||......|.|:.||:|.:.|::.     :||.... ||    |:||:||.||..:| 
 Frog   118 GQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGC 182

  Fly   112 -VGFAKS----GST----IYVVCNYNPPGNY 133
             |....:    |||    .|:||||:..||:
 Frog   183 AVNICTNINVWGSTWRQASYLVCNYSIKGNW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 39/147 (27%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 45/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.