DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl22E and DYNLRB1

DIOPT Version :9

Sequence 1:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001306086.1 Gene:DYNLRB1 / 83658 HGNCID:15468 Length:121 Species:Homo sapiens


Alignment Length:94 Identity:47/94 - (50%)
Similarity:63/94 - (67%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEF 67
            |||||.|||.||.|.|.||:||:.:|||||:|:|...|..||:||.:...|||..|.|:|..|:.
Human     2 AEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDL 66

  Fly    68 TFLRLRTEQNEVMLCPQEDYFIMVIQSPC 96
            ||||:|:::||:|:.|.:.    ...|||
Human    67 TFLRIRSKKNEIMVAPGKG----SSTSPC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 41/87 (47%)
DYNLRB1NP_001306086.1 Robl_LC7 4..87 CDD:214939 42/86 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.