DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl22E and Dynlrb2

DIOPT Version :9

Sequence 1:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_083573.1 Gene:Dynlrb2 / 75465 MGIID:1922715 Length:96 Species:Mus musculus


Alignment Length:94 Identity:46/94 - (48%)
Similarity:70/94 - (74%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEFT 68
            ||||.|||.||.|.|.|.:||:.:||||:||||.:.|:.||.|:..:..||:..|.|:|..|:.|
Mouse     3 EVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLT 67

  Fly    69 FLRLRTEQNEVMLCPQEDYFIMVIQSPCD 97
            |||:|::::|:|:.|.::|.::|||:||:
Mouse    68 FLRIRSKKHEIMVAPDKEYLLIVIQNPCE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 41/87 (47%)
Dynlrb2NP_083573.1 Robl_LC7 3..93 CDD:397386 43/89 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.