DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl22E and dynlrb2

DIOPT Version :9

Sequence 1:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_031755935.1 Gene:dynlrb2 / 549149 XenbaseID:XB-GENE-491537 Length:120 Species:Xenopus tropicalis


Alignment Length:95 Identity:46/95 - (48%)
Similarity:70/95 - (73%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEF 67
            |||||.|||.||.|.|.|.:||:.:||||:||||.:.|:.||.|:..:..||:..|.|:|..|:.
 Frog    26 AEVEETLKRIQSHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLSMKAKSTVRDIDPQNDL 90

  Fly    68 TFLRLRTEQNEVMLCPQEDYFIMVIQSPCD 97
            ||||:|::::|:|:.|.::|.::|||:|.:
 Frog    91 TFLRIRSKKHEIMVAPDKEYLLIVIQNPSE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 41/87 (47%)
dynlrb2XP_031755935.1 Robl_LC7 27..117 CDD:397386 43/89 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.