DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl22E and robl

DIOPT Version :9

Sequence 1:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster


Alignment Length:97 Identity:53/97 - (54%)
Similarity:75/97 - (77%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATN 65
            ||.||||.|||.||.|.|.|.:||:|:|||:|:|||.|.|:.||.||..:.:|||.||.|||.:|
  Fly     1 MSQEVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSN 65

  Fly    66 EFTFLRLRTEQNEVMLCPQEDYFIMVIQSPCD 97
            :.||||:|::::|:|:.|.:|:.::|||:|.|
  Fly    66 DMTFLRVRSKKHEIMVAPDKDFILIVIQNPTD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 46/87 (53%)
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 48/89 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I3549
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 1 1.000 - - otm14663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2120
109.930

Return to query results.
Submit another query.