DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl22E and Dynlrb1

DIOPT Version :9

Sequence 1:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_038960100.1 Gene:Dynlrb1 / 170714 RGDID:619910 Length:119 Species:Rattus norvegicus


Alignment Length:78 Identity:37/78 - (47%)
Similarity:53/78 - (67%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEFTFLRLRTEQNEVMLCPQ 84
            |..|...||||||:|:|...|..||.||.....|||..|.::|..|:.||||:|:::||:|:.|.
  Rat    42 GAAVSVRDGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPD 106

  Fly    85 EDYFIMVIQSPCD 97
            :|||::|||:|.:
  Rat   107 KDYFLIVIQNPTE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 35/73 (48%)
Dynlrb1XP_038960100.1 Robl_LC7 42..114 CDD:214939 33/71 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10779
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.