DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl22E and dynlrb1

DIOPT Version :9

Sequence 1:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001093687.1 Gene:dynlrb1 / 100101695 XenbaseID:XB-GENE-489076 Length:96 Species:Xenopus tropicalis


Alignment Length:95 Identity:48/95 - (50%)
Similarity:71/95 - (74%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEF 67
            |:|||.|||.|..|.|.||::|:::|||||:|:|...|:.||:||..:..|||..|.|:|..|:.
 Frog     2 ADVEETLKRIQGQKGVQGIIIVNSEGIPIKSTMDNQTTVQYASLMHQLVMKARGSVRDIDCQNDL 66

  Fly    68 TFLRLRTEQNEVMLCPQEDYFIMVIQSPCD 97
            ||||:|:::||:|:.|.:|||::|||.|.:
 Frog    67 TFLRIRSKKNEIMIAPDKDYFLIVIQQPTE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 44/87 (51%)
dynlrb1NP_001093687.1 Robl_LC7 5..92 CDD:308728 43/86 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.