DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl22E and dynlrb2

DIOPT Version :9

Sequence 1:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001289961.1 Gene:dynlrb2 / 100001191 ZFINID:ZDB-GENE-120709-101 Length:96 Species:Danio rerio


Alignment Length:95 Identity:43/95 - (45%)
Similarity:68/95 - (71%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEF 67
            ||||:.|||.|:...|.|.:||:.:||||:||||.:.::.||.|:..:..|||..|.|:|..||.
Zfish     2 AEVEDTLKRIQAQHGVIGTIVVNGEGIPIRTTLDNSTSVQYAGLLHQLTMKARSAVRDIDPQNEL 66

  Fly    68 TFLRLRTEQNEVMLCPQEDYFIMVIQSPCD 97
            ||||:|::::|:|:.|.::|.::.||:|.:
Zfish    67 TFLRIRSKKHEIMVAPDKEYLLIAIQNPSE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 38/87 (44%)
dynlrb2NP_001289961.1 Robl_LC7 5..93 CDD:281277 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.