DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and CALML4

DIOPT Version :10

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_219501.3 Gene:CALML4 / 91860 HGNCID:18445 Length:153 Species:Homo sapiens


Alignment Length:64 Identity:14/64 - (21%)
Similarity:27/64 - (42%) Gaps:15/64 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RKYLDRQGVLDAITQVLVKCNSERPDNALAFVLDNLTEKYVPLKAKLQEAHEEIDRLKAELSAL 76
            ||.....|:|:.:              :|||| ..|...|....|..::.|:|::|::...:.:
Human   332 RKATQTMGLLNIL--------------SLAFV-GGLPLAYQQTSAFARQPHDELERVRVSCAII 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 6/32 (19%)
CALML4NP_219501.3 PTZ00184 1..143 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.