DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and myl6

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_005166134.1 Gene:myl6 / 798632 ZFINID:ZDB-GENE-041010-28 Length:164 Species:Danio rerio


Alignment Length:152 Identity:45/152 - (29%)
Similarity:73/152 - (48%) Gaps:9/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHV--RQYEASTMQRICFDEV 104
            :.:|.|....||..|..||.||.....|..:||:|..|..|.|.|.:  ...|...|:.:.|::.
Zfish     6 EDQICEFKEAFLLFDRTGDGKIMYNQCGDVMRALGQNPVNAEVLKVLGNPSNEDMNMKMLDFEQF 70

  Fly   105 MGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDEL 169
            :.:..::.|:       |.|...:.||..|||||.:.:|.:....||.:||..||.|...||:.|
Zfish    71 LPMLQAIAKN-------KDQGSFEDFVEGLRVFDKEGNGTVMGAELRHVLTTLGEKMTEEEVETL 128

  Fly   170 LQGRINKDGLVDYKKLVQDIIY 191
            |.|..:.:|.::|:..:...::
Zfish   129 LAGHEDANGCINYEGTITHKVF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 45/143 (31%)
EFh 129..187 CDD:298682 22/57 (39%)
myl6XP_005166134.1 EFh 11..94 CDD:298682 24/89 (27%)
EF-hand_6 11..40 CDD:290141 11/28 (39%)
EFh 88..142 CDD:238008 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.