DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and Myl4

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:196 Identity:55/196 - (28%)
Similarity:84/196 - (42%) Gaps:24/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PSSTTPDCNQKRRGDMTAPPPNPKPEKSR-----------------IMEMHAIFLGHD--TRGDN 61
            |....|.....:.....||.|.|.||..|                 |.|....|...|  ..|:.
  Rat     3 PKKPEPKKETAKAAAAPAPAPAPAPEPLRDSAFDPKSVKIDFSADQIEEFKEAFSLFDRTPTGEM 67

  Fly    62 KISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDEVMGIYSSLGKHGGMLSPKKKQIE 126
            ||:....|..|||:|..||.|.|.:.:.:.:...|.....|..|  :..:.:|   :|..|:|..
  Rat    68 KITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKTLDFEM--FLPILQH---ISRNKEQGT 127

  Fly   127 ADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDIIY 191
            .:.||..|||||.:.:|.:....||.:|...||.|...||::||.|:.:.:|.::|:..|:.::.
  Rat   128 YEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLTGQEDANGCINYEAFVKHVMS 192

  Fly   192 G 192
            |
  Rat   193 G 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 44/143 (31%)
EFh 129..187 CDD:298682 21/57 (37%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 9/32 (28%)
PTZ00184 45..192 CDD:185504 45/151 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.