DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and Myl6

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_008763261.1 Gene:Myl6 / 685867 RGDID:1589019 Length:152 Species:Rattus norvegicus


Alignment Length:148 Identity:41/148 - (27%)
Similarity:69/148 - (46%) Gaps:9/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTM--QRICFDEVMGIYS 109
            |....|...|..||.||.....|..:||:|..||.|.|.|.:...::..|  :.:.|:..:.:..
  Rat    11 EFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQ 75

  Fly   110 SLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRI 174
            ::.|:       |.|...:.:|..|||||.:.:|.:....:|.:|...||.|...||:.|:.|..
  Rat    76 TVAKN-------KDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHE 133

  Fly   175 NKDGLVDYKKLVQDIIYG 192
            :.:|.::|:.....|.:|
  Rat   134 DSNGCINYEGKGHTINWG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 39/141 (28%)
EFh 129..187 CDD:298682 18/57 (32%)
Myl6XP_008763261.1 PTZ00184 5..142 CDD:185504 38/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.