DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and Myl1

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_038940068.1 Gene:Myl1 / 56781 RGDID:1598796 Length:232 Species:Rattus norvegicus


Alignment Length:199 Identity:54/199 - (27%)
Similarity:87/199 - (43%) Gaps:35/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SSIRPSSTTPDCNQKRRGDMTAPPPNPKPEKSR---------------------IMEMH----AI 51
            :|.|.|...| .....|.:::.|....||.:.|                     :.|:|    ..
  Rat    13 NSSRRSGNCP-VKSDTRYEVSLPRNKRKPPRGRTPLRDPLEVSSVHSPVPLLFCLPELHHEFKEA 76

  Fly    52 FLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHV--RQYEASTMQRICFDEVMGIYSSLGKH 114
            ||..|..|:.||::..:|..|||:|..||.|.|.|.:  ...|....::|.|::.:.:..:    
  Rat    77 FLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQA---- 137

  Fly   115 GGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGL 179
               :|..|.|...:.||..|||||.:.:|.:....||.:|...||.|...||:.||.|:.:.:|.
  Rat   138 ---ISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGC 199

  Fly   180 VDYK 183
            ::|:
  Rat   200 INYE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 45/145 (31%)
EFh 129..187 CDD:298682 21/55 (38%)
Myl1XP_038940068.1 PTZ00184 72..203 CDD:185504 42/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.