DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and CABP2

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001305425.1 Gene:CABP2 / 51475 HGNCID:1385 Length:226 Species:Homo sapiens


Alignment Length:161 Identity:52/161 - (32%)
Similarity:74/161 - (45%) Gaps:17/161 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PPPNP-----KPEKSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEA 93
            ||||.     :||:  |.|:...|...|...|..|..|.||.|:|.:|..|||..:.:..:|...
Human    72 PPPNSYDRELRPEE--IEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISG 134

  Fly    94 STMQRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRIL-TKT 157
            ..:....|.|:||        ..:|:.....|...:...:.|.|||:..|.|....||..| ...
Human   135 GKVDFEDFVELMG--------PKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALL 191

  Fly   158 GECMGSMEVDELLQG-RINKDGLVDYKKLVQ 187
            ||.:...||||:||. .:|.|||||:::.|:
Human   192 GERLSQREVDEILQDVDLNGDGLVDFEEFVR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 45/143 (31%)
EFh 129..187 CDD:298682 23/59 (39%)
CABP2NP_001305425.1 FRQ1 78..226 CDD:227455 48/155 (31%)
EF-hand_6 88..117 CDD:290141 10/28 (36%)
EF-hand_8 133..188 CDD:290545 14/62 (23%)
EFh 162..225 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.