DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and MYL4

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_011523141.2 Gene:MYL4 / 4635 HGNCID:7585 Length:228 Species:Homo sapiens


Alignment Length:136 Identity:41/136 - (30%)
Similarity:71/136 - (52%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GDNKISIRHLGHCLRAMGATPTEAMVSKHV--RQYEASTMQRICFDEVMGIYSSLGKHGGMLSPK 121
            |:.||:....|..|||:|..||.|.|.:.:  .:.|...::.:.|:..:.|...:.::       
Human   100 GEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRN------- 157

  Fly   122 KKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLV 186
            |:|...:.||..|||||.:.:|.:....||.:|...||.|...||::||.|:.:.:|.::|:..|
Human   158 KEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFV 222

  Fly   187 QDIIYG 192
            :.|:.|
Human   223 KHIMSG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 38/129 (29%)
EFh 129..187 CDD:298682 21/57 (37%)
MYL4XP_011523141.2 EFh_PEF 86..227 CDD:330173 40/133 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.