DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and MYL1

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:175 Identity:52/175 - (29%)
Similarity:84/175 - (48%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 APPPNPKPEKSRIMEMHAI---------------FLGHDTRGDNKISIRHLGHCLRAMGATPTEA 82
            ||.|.|...|...:::.||               ||..|..||:||::..:|..|||:|..||.|
Human    25 APAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNA 89

  Fly    83 MVSKHV--RQYEASTMQRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWI 145
            .|.|.:  ...|....::|.|::.:.:..:       :|..|.|...:.||..|||||.:.:|.:
Human    90 EVRKVLGNPSNEELNAKKIEFEQFLPMMQA-------ISNNKDQATYEDFVEGLRVFDKEGNGTV 147

  Fly   146 PAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDII 190
            ....||.:|...||.|...||:.|:.|:.:.:|.::|:..|:.|:
Human   148 MGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 45/158 (28%)
EFh 129..187 CDD:298682 20/57 (35%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 4/9 (44%)
PTZ00184 45..193 CDD:185504 45/155 (29%)
EFh 54..118 CDD:298682 20/63 (32%)
EF-hand_6 54..83 CDD:290141 11/28 (39%)
EFh 131..192 CDD:238008 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S901
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.