DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and cabp1b

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001002414.1 Gene:cabp1b / 436687 ZFINID:ZDB-GENE-040718-111 Length:167 Species:Danio rerio


Alignment Length:154 Identity:40/154 - (25%)
Similarity:74/154 - (48%) Gaps:15/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KPEKSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFD- 102
            :||:  :.|:...|...|...|..|..:.||:|:|.||..|||..:.:..:|...:....:.|: 
Zfish    20 RPEE--MDELREAFKEFDKDKDGFIGCKDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFED 82

  Fly   103 --EVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTK-TGECMGSM 164
              |:||        ..:|:.....|...:...:.:.|||:..|.|....||..:.| .|:.:|..
Zfish    83 FVELMG--------PKLLAETADMIGVKELRDAFKEFDTNGDGQISTAELREAMKKLLGQQVGHR 139

  Fly   165 EVDELLQG-RINKDGLVDYKKLVQ 187
            :::::|:. .:|.||.||:::.|:
Zfish   140 DLEDILRDIDLNGDGHVDFEEFVR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 37/146 (25%)
EFh 129..187 CDD:298682 16/59 (27%)
cabp1bNP_001002414.1 PTZ00184 18..165 CDD:185504 40/154 (26%)
EFh 26..87 CDD:238008 17/60 (28%)
EFh 103..166 CDD:238008 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.