DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and Mlc1

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster


Alignment Length:156 Identity:37/156 - (23%)
Similarity:74/156 - (47%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PKPEKSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFD 102
            ||.|...:..:..: :|....|.:.:.   ||..|||:...||.|::.| :...:....::|..|
  Fly     5 PKREVENVEFVFEV-MGSPGEGIDAVD---LGDALRALNLNPTLALIEK-LGGTKKRNEKKIKLD 64

  Fly   103 EVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVD 167
            |.:.|||.:.|       :|:|...:.|:..|:::|.:::|.:....|:..|...||.:...:|:
  Fly    65 EFLPIYSQVKK-------EKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVE 122

  Fly   168 ELLQGRI---NKDGLVDYKKLVQDII 190
            .|....:   :.:|.:.|.:.||.::
  Fly   123 TLFADCMDPEDDEGFIPYSQFVQRLM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 32/144 (22%)
EFh 129..187 CDD:298682 12/60 (20%)
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 37/156 (24%)
EFh 84..148 CDD:298682 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471559
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D134752at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.