DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and CG17770

DIOPT Version :10

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster


Alignment Length:166 Identity:33/166 - (19%)
Similarity:72/166 - (43%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DMTAPPPNPKP------EKSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHV 88
            :...|||..:.      .:.::.::...|...|.:....|.|.:|...:.::...|::..:.:..
  Fly     4 EFLTPPPEERTIRTHNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQ 68

  Fly    89 RQYEASTMQRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRI 153
            .:.:|.....:...:.:.|.|.  ::..|.:       .|:.:::.||||.:.:|.|.....|.|
  Fly    69 AEIDADGSGELYLSDFLHIMSQ--RYANMST-------EDEIIAAFRVFDKEGTGLISESEFRHI 124

  Fly   154 LTKTGECMGSMEVDELLQGRINKD--GLVDYKKLVQ 187
            :...||.:...||:|:::. .|.|  |.:||.:.|:
  Fly   125 MQNMGEQLTDDEVEEIIRD-ANSDLEGNIDYVRFVR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 29/143 (20%)
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 30/151 (20%)

Return to query results.
Submit another query.