DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and zgc:153867

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_017209013.1 Gene:zgc:153867 / 337226 ZFINID:ZDB-GENE-030131-9170 Length:209 Species:Danio rerio


Alignment Length:192 Identity:56/192 - (29%)
Similarity:91/192 - (47%) Gaps:29/192 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QLHPSSIRPSSTTPDCNQKRRGDMTAPPPNPKPEKS-----RIMEMHAIFLGHDTRGDNKISIRH 67
            :|.|..:|||.:               |.:|...:|     :|:|....||..|..||.||:...
Zfish    40 ELKPRMLRPSDS---------------PFDPSTLESDFSEDQILEFKEAFLLFDRTGDGKITYNQ 89

  Fly    68 LGHCLRAMGATPTEAMVSKHVRQYEASTMQR--ICFDEVMGIYSSLGKHGGMLSPKKKQIEADQF 130
            .|..:||:|..|..|.|.|.:...:|..|..  :.|::.:.:..::.|:       |.|...:.|
Zfish    90 CGDVMRALGQNPVNAEVLKVLGNPKAEEMNHKLLDFEQFLPMLQAIAKN-------KDQGTFEDF 147

  Fly   131 VSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDIIYG 192
            |..|||||.:.:|.:....||.:||..||.|...||:.||.|..:.:|.::|::||:.::.|
Zfish   148 VEGLRVFDKEGNGTVMGAELRHVLTTLGEKMTEEEVETLLAGHEDANGCINYEELVRMVMSG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 46/143 (32%)
EFh 129..187 CDD:298682 23/57 (40%)
zgc:153867XP_017209013.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.