DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and CG17493

DIOPT Version :10

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster


Alignment Length:52 Identity:12/52 - (23%)
Similarity:24/52 - (46%) Gaps:4/52 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QVLVKCNSERPDNALAFVLDNLTEKYVPLKAKLQEAHEEIDRLKAELSALKV 78
            ::|.|......||.::|..:::.    .::.||:|...|..|...|...::|
  Fly    44 KLLKKTEINPKDNHISFQCESME----AVEKKLKEMEIEYVRAVVEEGGIQV 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 7/34 (21%)
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 12/52 (23%)

Return to query results.
Submit another query.