DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and CG34435

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster


Alignment Length:180 Identity:46/180 - (25%)
Similarity:74/180 - (41%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DCNQKRRGDMTAPPPNPKPEKSRIMEMHAIFLGHDTRGDNKISIR--HLGHCLRAMGATPT---- 80
            :|:|...|:..|.|                     |..|..|.||  .:..|||.||..|:    
  Fly    43 ECDQAAGGEDVAAP---------------------TCLDLGIGIRMTDVADCLRIMGLNPSDDEL 86

  Fly    81 EAMVSKHVRQYEASTM------QRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDT 139
            :..:.:|||:.|:..|      ||..|:.|:.:|..|.:.  .:....|....:..:..||..|:
  Fly    87 QQRLEEHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQ--EVKEMAKGCIVENVLRVLRSRDS 149

  Fly   140 DKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDI 189
            ..:|.:|..:||.:||..|..:...||..:|....:.:|.|.|:.||..:
  Fly   150 AGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 40/153 (26%)
EFh 129..187 CDD:298682 17/57 (30%)
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 46/180 (26%)
FRQ1 <188..297 CDD:227455 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.