DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and Cabp2

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_006531826.1 Gene:Cabp2 / 29866 MGIID:1352749 Length:324 Species:Mus musculus


Alignment Length:186 Identity:55/186 - (29%)
Similarity:82/186 - (44%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GNQLHPSSI--RPSSTTPDCNQKRRGDMTAPPPNPKPEKSRIMEMHAIFLGHDTRGDNKISIRHL 68
            |:.:.|:.|  |||......:::.|           ||:  |.|:...|...|...|..|..|.|
Mouse   156 GSLVGPACIFLRPSIAATQLDRELR-----------PEE--IEELQIAFQEFDRDRDGYIGYREL 207

  Fly    69 GHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSS 133
            |.|:|.:|..|||..:.:..:|.....:....|.|:||        ..:|:.....|...:...:
Mouse   208 GACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMG--------PKLLAETADMIGVRELRDA 264

  Fly   134 LRVFDTDKSGWIPAIRLRRIL-TKTGECMGSMEVDELLQG-RINKDGLVDYKKLVQ 187
            .|.|||:..|.|....||..| ...||.:...||||:||. .:|.|||||:::.|:
Mouse   265 FREFDTNGDGCISVGELRAALKALLGERLSQREVDEILQDIDLNGDGLVDFEEFVR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 45/143 (31%)
EFh 129..187 CDD:298682 23/59 (39%)
Cabp2XP_006531826.1 FRQ1 166..324 CDD:227455 52/176 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.