DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and cdc4

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_594947.1 Gene:cdc4 / 2541699 PomBaseID:SPAP8A3.08 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:43/135 - (31%)
Similarity:68/135 - (50%) Gaps:11/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDEVMGIYSSLGKHGGMLSP 120
            |..|..:|....:|..|||.|..||.|    .:.:.|::....:..::.:.:   |.:..|...|
pombe    16 DRHGTGRIPKTSIGDLLRACGQNPTLA----EITEIESTLPAEVDMEQFLQV---LNRPNGFDMP 73

  Fly   121 KKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKL 185
            .    :.::||...:|||.|.:|.|....||.:||..||.:.:.|:||||:|...|||:|:|...
pombe    74 G----DPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDF 134

  Fly   186 VQDII 190
            ||.|:
pombe   135 VQMIL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 40/130 (31%)
EFh 129..187 CDD:298682 25/57 (44%)
cdc4NP_594947.1 PTZ00184 8..141 CDD:185504 43/135 (32%)
EF-hand_6 8..36 CDD:290141 7/19 (37%)
EFh 78..138 CDD:238008 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I2905
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.