DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and Myl3

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_036738.1 Gene:Myl3 / 24585 RGDID:3142 Length:200 Species:Rattus norvegicus


Alignment Length:180 Identity:45/180 - (25%)
Similarity:82/180 - (45%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 APPPNPKPEKSRIMEMHAI-------------------FLGHDTRGDNKISIRHLGHCLRAMGAT 78
            ||...|:||:.:..|..|.                   ......:|:.||:....|..|||:|..
  Rat    27 APAAAPEPERPKEAEFDASKIKIEFTPEQIEEFKEAFQLFDRTPKGEMKITYGQCGDVLRALGQN 91

  Fly    79 PTEAMVSKHV---RQYEASTMQRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTD 140
            ||:|.|.:.:   :|.|.:: :.:.|:..:.:...:.|:       |.....:.||..|||||.:
  Rat    92 PTQAEVLRVLGKPKQEELNS-KMMDFETFLPMLQHISKN-------KDTGTYEDFVEGLRVFDKE 148

  Fly   141 KSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDII 190
            .:|.:....||.:|...||.:...||::|:.|:.:.:|.::|:..|:.|:
  Rat   149 GNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIM 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 38/163 (23%)
EFh 129..187 CDD:298682 19/57 (33%)
Myl3NP_036738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 5/14 (36%)
PTZ00184 49..199 CDD:185504 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.