DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and cal-5

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_508864.2 Gene:cal-5 / 192083 WormBaseID:WBGene00006861 Length:156 Species:Caenorhabditis elegans


Alignment Length:177 Identity:37/177 - (20%)
Similarity:64/177 - (36%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CNQKRRGDMTAPPPNPKPEKSRIME--MHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVS 85
            |:.|::.         :.|...|.|  :..||...|..||..|....|...::.||.:|||..:.
 Worm     5 CSSKKKN---------QGEVGEIREDDLKGIFREFDLNGDGYIQREELRAVMQKMGQSPTEDELD 60

  Fly    86 KHVRQYEASTMQRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVF---DTDKSGWIPA 147
            ...:..:......|.|.|.:.|..:        :|....::|        ||   |.|..|:|..
 Worm    61 AMFQAADKDCDGNIDFQEFLVIAKA--------NPLSLSLKA--------VFEELDVDGDGYITR 109

  Fly   148 IRLRRILTKTGECMGSME-------VDELLQGRINKDGLVDYKKLVQ 187
            ..||....:.|..:...:       ||:      |.||.:::::..:
 Worm   110 SELRTAFQRMGHSLSDQDIKAIYRHVDQ------NNDGKINFQEFCE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 34/153 (22%)
EFh 129..187 CDD:298682 14/67 (21%)
cal-5NP_508864.2 PTZ00184 22..155 CDD:185504 32/151 (21%)
EFh 22..84 CDD:238008 16/61 (26%)
EFh 92..153 CDD:238008 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.