DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and mlc-6

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_510375.2 Gene:mlc-6 / 186979 WormBaseID:WBGene00010554 Length:143 Species:Caenorhabditis elegans


Alignment Length:144 Identity:34/144 - (23%)
Similarity:69/144 - (47%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDEVMGIYSSL 111
            |...:|:..|.:||.||....:...||::...|..:.|.:.:.:::.:.  ||.|:..:.:.|.:
 Worm     9 ECREVFMLFDKKGDGKIDAAQVFEVLRSLDENPKNSDVHQCLAKFDKTA--RISFENFLPVLSHV 71

  Fly   112 GKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINK 176
            ..:       |.....:.|:..|..||.:..|:|.:..||::||..|:.:...|.|:|:.|: ..
 Worm    72 RNN-------KIPYSMEDFIKGLSHFDKEGEGFITSAELRQVLTTMGDKLSDEEFDKLVAGQ-ED 128

  Fly   177 DGLVDYKKLVQDII 190
            :|.:..:..|:.|:
 Worm   129 NGKIKIETFVKTIM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 32/139 (23%)
EFh 129..187 CDD:298682 16/57 (28%)
mlc-6NP_510375.2 PTZ00184 5..143 CDD:185504 34/144 (24%)
EFh 9..65 CDD:238008 14/57 (25%)
EFh 82..142 CDD:298682 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S901
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.