DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and cal-7

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_505510.2 Gene:cal-7 / 185545 WormBaseID:WBGene00009585 Length:179 Species:Caenorhabditis elegans


Alignment Length:154 Identity:37/154 - (24%)
Similarity:66/154 - (42%) Gaps:24/154 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDE--- 103
            :.|:.::..:|   |...|..|....:.|.||:.|..|::..: :.|.:..|....|:.||:   
 Worm    34 RRRLFDVFKMF---DEDSDGLIETDDVSHVLRSFGLNPSQTEL-QLVSEQTAKKNGRVSFDDLLP 94

  Fly   104 --VMGIYSSLGKHGGMLSPKKKQIEAD-QFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSME 165
              |:.|.:...|     ....|||.|. |.::|        :.::....|.::||..||.:...|
 Worm    95 RVVLAIQNEEWK-----DDTPKQIHAAFQVITS--------NNYVQKDTLLQLLTSIGEPLTPQE 146

  Fly   166 VDELLQG-RINKDGLVDYKKLVQD 188
            |.:.|.. .|..:|.:|:...|:|
 Worm   147 VKQFLNHVSIRANGDIDWVSYVKD 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 34/148 (23%)
EFh 129..187 CDD:298682 13/58 (22%)
cal-7NP_505510.2 PTZ00184 41..169 CDD:185504 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.