DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and F43C9.2

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_508818.1 Gene:F43C9.2 / 180753 WormBaseID:WBGene00018376 Length:159 Species:Caenorhabditis elegans


Alignment Length:137 Identity:29/137 - (21%)
Similarity:57/137 - (41%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDEVMGIYSSLGKHGGMLSP 120
            |...|.::|...:...||.:...||...:.....:.:.....:|..:|.:....|...|...|  
 Worm    32 DVDKDGRLSRNEIAALLRTINVEPTRVELDFIFGEMDTDKTGKISKEEFVNYMKSPPIHRTTL-- 94

  Fly   121 KKKQIEADQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGR-INKDGLV---D 181
              :::|. ||    |.||:|..|.|....:..||.:|.:......:.::.:.. :|.||.:   :
 Worm    95 --RELEV-QF----RKFDSDGDGAITEDEMAEILRRTADLGDRAAISDMFKATDLNGDGKITFFE 152

  Fly   182 YKKLVQD 188
            :.|::|:
 Worm   153 FVKMMQE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 28/134 (21%)
EFh 129..187 CDD:298682 15/61 (25%)
F43C9.2NP_508818.1 EF-hand_7 24..84 CDD:290234 9/51 (18%)
EFh 25..85 CDD:298682 9/52 (17%)
EFh 96..158 CDD:238008 16/66 (24%)
EF-hand_7 101..157 CDD:290234 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.