DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and mlc-7

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001022669.1 Gene:mlc-7 / 176811 WormBaseID:WBGene00023451 Length:153 Species:Caenorhabditis elegans


Alignment Length:149 Identity:49/149 - (32%)
Similarity:72/149 - (48%) Gaps:31/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSRIM-EMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRICFDEVM 105
            :.|:| |:|.:|..|||.||.||..:.|...||||...||||::::..:...:..  ||..:|.:
 Worm     3 QQRLMDEVHDVFHFHDTLGDGKIDSKQLPTALRAMMLNPTEALLAEVSKARTSGA--RITVEEFI 65

  Fly   106 GIYSSLGKHGGMLSPKKKQIEA--------DQFVSSLRVFDTDKSGWIPAIRLRRILTKTGECMG 162
            .||              |::||        .:|.:.|..||.:.:|.|..:.|:.:|...||.|.
 Worm    66 PIY--------------KKVEAACGRSTTLKEFQTLLSHFDREGNGQIMLMELKSMLQNGGEKMT 116

  Fly   163 SMEVDELL------QGRIN 175
            :.|||.||      .||||
 Worm   117 NQEVDNLLFGVEVVDGRIN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 48/146 (33%)
EFh 129..187 CDD:298682 20/53 (38%)
mlc-7NP_001022669.1 FRQ1 8..139 CDD:227455 47/144 (33%)
EFh 9..65 CDD:298682 22/57 (39%)
EF-hand_8 55..109 CDD:290545 15/69 (22%)
EFh 83..140 CDD:298682 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28942
OrthoDB 1 1.010 - - D1424914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.