Sequence 1: | NP_608666.1 | Gene: | CG17237 / 33411 | FlyBaseID: | FBgn0031410 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028848.1 | Gene: | Cabp1 / 171051 | RGDID: | 620385 | Length: | 350 | Species: | Rattus norvegicus |
Alignment Length: | 233 | Identity: | 58/233 - (24%) |
---|---|---|---|
Similarity: | 91/233 - (39%) | Gaps: | 61/233 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SRKGNQLHPSSIRPSSTTP--------------------DCNQKRRGDMTAPPPNP--------- 38
Fly 39 --------------KPEKSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVR 89
Fly 90 QYEASTMQRICFD---EVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLR 151
Fly 152 RILTK-TGECMGSMEVDELLQG-RINKDGLVDYKKLVQ 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17237 | NP_608666.1 | PTZ00184 | 45..187 | CDD:185504 | 41/146 (28%) |
EFh | 129..187 | CDD:298682 | 17/59 (29%) | ||
Cabp1 | NP_001028848.1 | PTZ00184 | 201..348 | CDD:185504 | 44/156 (28%) |
EFh | 209..312 | CDD:238008 | 31/110 (28%) | ||
EFh | 286..349 | CDD:238008 | 18/61 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1424914at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |