DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and Cabp1

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001028848.1 Gene:Cabp1 / 171051 RGDID:620385 Length:350 Species:Rattus norvegicus


Alignment Length:233 Identity:58/233 - (24%)
Similarity:91/233 - (39%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRKGNQLHPSSIRPSSTTP--------------------DCNQKRRGDMTAPPPNP--------- 38
            ||:|  |..:..||..|.|                    ....:.||| .||...|         
  Rat   127 SRRG--LPQAHCRPRETLPPARGRDGEERGLAPALSLRGSLRSRGRGD-PAPAGTPEADPFLHQL 188

  Fly    39 --------------KPEKSRIMEMHAIFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVR 89
                          :||:  |.|:...|...|...|..|:.|.||:|:|.||..|||..:.:..:
  Rat   189 RPMLSSAFGQDRSLRPEE--IEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQ 251

  Fly    90 QYEASTMQRICFD---EVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRLR 151
            |...:....:.||   |:||        ..:|:.....|...:...:.|.|||:..|.|....||
  Rat   252 QINMNLGGHVDFDDFVELMG--------PKLLAETADMIGVKELRDAFREFDTNGDGEISTSELR 308

  Fly   152 RILTK-TGECMGSMEVDELLQG-RINKDGLVDYKKLVQ 187
            ..:.| .|..:|..:::|:::. .:|.||.||:::.|:
  Rat   309 EAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVR 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 41/146 (28%)
EFh 129..187 CDD:298682 17/59 (29%)
Cabp1NP_001028848.1 PTZ00184 201..348 CDD:185504 44/156 (28%)
EFh 209..312 CDD:238008 31/110 (28%)
EFh 286..349 CDD:238008 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.