DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17237 and MYL6B

DIOPT Version :9

Sequence 1:NP_608666.1 Gene:CG17237 / 33411 FlyBaseID:FBgn0031410 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001186558.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:188 Identity:48/188 - (25%)
Similarity:84/188 - (44%) Gaps:20/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PSSIRPSSTTPDCNQKRRGDMTAPPPNPKPE------KSRIMEMHAIFLGHDTRGDNKISIRHLG 69
            |:..:.....|...||     |..||....:      |.::.|....|...|..||.||.....|
Human    31 PAKTKAEPAVPQAPQK-----TQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCG 90

  Fly    70 HCLRAMGATPTEAMVSKHVRQYEASTM--QRICFDEVMGIYSSLGKHGGMLSPKKKQIEADQFVS 132
            ..:||:|..||.|.|.|.:...::..:  :|:.|:..:.:..::.|:.|       |...:.::.
Human    91 DVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRG-------QGTYEDYLE 148

  Fly   133 SLRVFDTDKSGWIPAIRLRRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDII 190
            ..||||.:.:|.:....||.:||..||.|...||:.:|.|..:.:|.::|:..::.|:
Human   149 GFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHIL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17237NP_608666.1 PTZ00184 45..187 CDD:185504 39/143 (27%)
EFh 129..187 CDD:298682 18/57 (32%)
MYL6BNP_001186558.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 5/24 (21%)
PTZ00184 58..207 CDD:185504 41/156 (26%)
EFh 68..132 CDD:298682 18/63 (29%)
EFh 68..96 CDD:197492 9/27 (33%)
EFh 150..205 CDD:238008 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.