DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and tmprss5

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:246 Identity:67/246 - (27%)
Similarity:114/246 - (46%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKR----------ITVRV 73
            |..||||....|.:..|::.:..|.|||::|.::.::|||.||.|..:.:          ||..:
Zfish   312 IIGGVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITSNL 376

  Fly    74 GTPDIYRGGRIIRVTALVVHENY--KNWDNDIALLWLEKPVL---SVRVTKIPLATKEPSENEYP 133
            .....|:|..:.|:   :.::||  :..||||||:.|:.|:.   ::|...:|     ..:::.|
Zfish   377 AKLAQYQGFAVERI---IYNKNYNHRTHDNDIALVKLKTPLNFSDTIRPVCLP-----QYDHDLP 433

  Fly   134 SN-----AGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELV--EPVGEELLCAFYTEN--DICP 189
            ..     :|||....:..::...|:.....:.....|....:  ..:...:|||.|:|.  |.|.
Zfish   434 GGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYNGEITSRMLCAGYSEGKVDACQ 498

  Fly   190 GDYGGPLVLAN----KVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEENAE 236
            ||.|||||..:    ::||:...|.||.....|.:|:.|..:|.||.:..|
Zfish   499 GDSGGPLVCQDENVWRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWIYDIIE 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 66/242 (27%)
Tryp_SPc 19..231 CDD:214473 64/239 (27%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 64/239 (27%)
Tryp_SPc 312..547 CDD:238113 66/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.