DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and PRSS8

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:288 Identity:76/288 - (26%)
Similarity:120/288 - (41%) Gaps:63/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IGSCWVLILFA--RSSNG---------------IYNGVEAKFDFWTFLASVWVSGYHECGGAVID 50
            :|:..:|:...  ||..|               |..|..|....|.:..|:...|.|.|||:::.
Human    12 LGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVS 76

  Fly    51 SRIVLTAAQCVKNKPVKR-ITVRVGTP--DIY-RGGRIIRVTALVVHENY--KNWDNDIALLWLE 109
            .:.||:||.|..::..|. ..|::|..  |.| ...::..:..::.|.:|  :....|||||.|.
Human    77 EQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLS 141

  Fly   110 KPVLSVRVTKIPLATKEPSEN-EYPSN-----AGWGE-------------KLLESYVVTRKLQNG 155
            :|:...|..: |:..  |:.| .:|:.     .|||.             :.||..:::|:..|.
Human   142 RPITFSRYIR-PICL--PAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNC 203

  Fly   156 VTKI--RPRSMCAEELVEP--VGEELLCAFYTE--NDICPGDYGGPLVLANK----VVGIAVQGH 210
            :..|  :|.        ||  |.|:::||.|.|  .|.|.||.||||....:    :.||...|.
Human   204 LYNIDAKPE--------EPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGD 260

  Fly   211 GCGFAVLPSLYTNVFHYLEWIEENAEKL 238
            .||....|.:||....|..||:....:|
Human   261 ACGARNRPGVYTLASSYASWIQSKVTEL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 70/249 (28%)
Tryp_SPc 19..231 CDD:214473 68/246 (28%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 68/247 (28%)
Tryp_SPc 45..284 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.