DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:257 Identity:72/257 - (28%)
Similarity:112/257 - (43%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIGSCWVLILFARSSNGIYNG------VEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQ 59
            :|:..|.:|.:.|.|...:...      |.|.:.....::....:|.|.|||.:|:...|||||.
Zfish     4 LLLLLCVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLTAAH 68

  Fly    60 CVKNKPVKRITVRVGTPDIYRG-GRIIRVTALVVHENYKNWDN--DIALLWLEKPV-LSVRVTKI 120
            |...:...||.....:..:|.| .:..|...|:.|..|....|  ||.|:.|:.|| |:..|:.:
Zfish    69 CNIGEANMRIVAGDYSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSPVYLNSYVSLV 133

  Fly   121 PLATKEP--SENEYPSNAGWG--------EKLLESY---VVTRKLQNGVTKIRPRSMCAEELVEP 172
            ||..::.  :.....|.:|||        ..:|.:.   :|:..:.||.......          
Zfish   134 PLPRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAVCNGTDSFNGN---------- 188

  Fly   173 VGEELLCAFYTE--NDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIE 232
            :.|.::||.|:.  .|.|.||.|||||...:|.||...|:||..|..|.:||.|..:.:||:
Zfish   189 ITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFRQWID 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 67/239 (28%)
Tryp_SPc 19..231 CDD:214473 65/236 (28%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 65/232 (28%)
Tryp_SPc 27..252 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.