DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and Egfbp2

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:271 Identity:75/271 - (27%)
Similarity:111/271 - (40%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WVLILFARSSNG-----------IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQC 60
            |.||||...|.|           :..|...|.:...:..:|:....|.|||.::|...|||||.|
Mouse     2 WFLILFLALSLGGIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHC 66

  Fly    61 VKNKPVKRITVRVGTPDIYR---GGRIIRVTALVVHENYK-------------NWDNDIALLWLE 109
            .    |.:..|.:|...:::   ..:...|:....|..:.             ::.||:.||.|.
Mouse    67 Y----VDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSNDLMLLRLS 127

  Fly   110 KPVLSVRVTK-IPLATKEPSENEYPSNAGWGEKLLESYVVTR-----KLQNGVTKIRPRSMCAEE 168
            ||.....|.| |.|.||||........:|||     |...||     .||.....:.|...||:.
Mouse   128 KPADITDVVKPIALPTKEPKPGSKCLASGWG-----SITPTRWQKPDDLQCVFITLLPNENCAKV 187

  Fly   169 LVEPVGEELLCA--FYTENDICPGDYGGPLVLANKVVGIAVQGH-GCGFAVLPSLYTNVFHYLEW 230
            .::.|.:.:|||  .....|.|..|.||||:....:.|....|. .||...:|::|||:..:..|
Mouse   188 YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSW 252

  Fly   231 IEENAEKLIKN 241
            |::.   ::||
Mouse   253 IKDT---MMKN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 66/239 (28%)
Tryp_SPc 19..231 CDD:214473 64/236 (27%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 64/237 (27%)
Tryp_SPc 25..256 CDD:238113 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.