DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and AgaP_AGAP005310

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_315325.4 Gene:AgaP_AGAP005310 / 1276024 VectorBaseID:AGAP005310 Length:256 Species:Anopheles gambiae


Alignment Length:238 Identity:62/238 - (26%)
Similarity:111/238 - (46%) Gaps:11/238 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLILFARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQC-VKNK---PVKR 68
            |.|..|.....:.:|.:|:...:.:..::.:.....|||.::..|..||||.| .|.:   |:::
Mosquito    14 VSIAHANVVGRVADGSDARRGQFPYQVAMTLKRQTVCGGVMVHERFFLTAAHCFFKGETPLPLEQ 78

  Fly    69 ITVRVGTPDIYRGGRIIRVTALVVHENYKNWDN-DIALLWLEKPV-LSVRVTKIPLATKEPSENE 131
            :.|..|:..::..||..||..:..||.|.:... |:|::.:::.. |:.....:....:...||.
Mosquito    79 LNVFYGSEKLFSNGRYNRVKTVHFHEQYDHGTKYDLAVVEVKRKFDLTSASRPVEFGQEAFGENL 143

  Fly   132 YPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFYTEN-DICPGDYGGP 195
            ..:..|:|...:|..:..|.....:|.: |.|.|.|.:.|...|.:.|...:.. ..|.||||||
Mosquito   144 LATVTGYGRNTVEGNMAFRLKYAQLTSL-PDSQCREAMGEDYYEGVFCLDTSAGAGFCLGDYGGP 207

  Fly   196 LVLANKVVGIA--VQGHGCGFAVLPSLYTNVFHYLEWIEENAE 236
            .|..:::||:.  ..|..|. |.||.::.:|.|:.||::...|
Mosquito   208 AVFEDRLVGVGSYTVGGKCE-AGLPDVFVDVGHFSEWVQSVLE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 58/223 (26%)
Tryp_SPc 19..231 CDD:214473 57/220 (26%)
AgaP_AGAP005310XP_315325.4 Tryp_SPc 21..247 CDD:238113 58/227 (26%)
Tryp_SPc 24..244 CDD:214473 57/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.