DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:208 Identity:73/208 - (35%)
Similarity:103/208 - (49%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CGGAVIDSRIVLTAAQCVKNKPVKRIT-VRVGTPDIYRGGRIIRVTALVVHENYK--NWDNDIAL 105
            |||::|.:|.:||||.||.|..|..:| |||||.|.|.||.:.::..::.||.|.  .:.||:||
Mosquito    61 CGGSIIAARWILTAAHCVTNVNVTNLTVVRVGTNDNYEGGSMYQIDRVIPHERYSAITFRNDVAL 125

  Fly   106 LWLEKPV-LSVRVTKIPLATKEPSENEYPSNA-----GWG------EKLLESYVVTRKLQN-GVT 157
            |.|:.|: ....|.||.|     :|...|.||     |||      |....:.|:  |:|: |:.
Mosquito   126 LRLKTPIKFEEHVEKIEL-----NEELVPINATLTIVGWGFVGWNKENPKRTQVI--KVQHIGLN 183

  Fly   158 KIRPRSMCAEELVEPVGEELLCAF-YTENDICPGDYGGPLVLANKVVGI---AVQGHGCGFAVLP 218
              |.|.|.....:.|   |.||.| ...:..|.||.|.|:|...|.||:   |:.| .|... ||
Mosquito   184 --RCRKMANGSAIYP---EHLCTFSRAGHGPCKGDSGSPVVWKGKQVGVVSWAMAG-VCAIG-LP 241

  Fly   219 SLYTNVFHYLEWI 231
            .:..::.::..||
Mosquito   242 DVQASIRYFYGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 73/208 (35%)
Tryp_SPc 19..231 CDD:214473 71/206 (34%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 73/208 (35%)
Tryp_SPc 35..254 CDD:214473 71/206 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.