DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and CLIPC5

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_310507.4 Gene:CLIPC5 / 1271651 VectorBaseID:AGAP000571 Length:374 Species:Anopheles gambiae


Alignment Length:235 Identity:71/235 - (30%)
Similarity:105/235 - (44%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGY-HECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYR-------GGRIIRVTALVVHEN 95
            :|| ..||.::|..|.:||||.|::......:..|:||.|:..       ..|.|:  .::||..
Mosquito   142 AGYLWACGSSLITVRFLLTAAHCIRTPHGMPVVARMGTIDLLSPPVPADVQDRSIK--NIIVHPQ 204

  Fly    96 YKNWDNDIALLWLEKPVLSVRVTKIPLATKEPSENEYP----SNAGWGEK--------LLESYVV 148
            |:|..:|||||.:..| ..:.|...|:..:..::...|    ..||||:.        ||.:.:.
Mosquito   205 YRNKYDDIALLEVTDP-FQMDVVLQPICLRTDTDEFGPDVVLQVAGWGQTEESTSSAGLLRANLS 268

  Fly   149 TRKLQN-----------GVTKIRPRSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLAN-- 200
            |..:..           .|..|||...||.....| ||:   .:|  :|.|.||.||||....  
Mosquito   269 TVPVAECDRTYAGAMLAKVKSIRPSQYCARGFRAP-GED---NWY--SDSCEGDSGGPLYHVEGE 327

  Fly   201 ------KVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEEN 234
                  .:||:...|.|||.:. ||:||.|.:||:|||.:
Mosquito   328 EGSSKYYLVGVTSFGLGCGSST-PSVYTRVAYYLDWIESH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 71/233 (30%)
Tryp_SPc 19..231 CDD:214473 68/230 (30%)
CLIPC5XP_310507.4 CLIP 30..77 CDD:197829
Tryp_SPc 109..363 CDD:214473 68/230 (30%)
Tryp_SPc 110..366 CDD:238113 71/233 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.