DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and CLIPC10

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_310506.4 Gene:CLIPC10 / 1271650 VectorBaseID:AGAP000572 Length:380 Species:Anopheles gambiae


Alignment Length:258 Identity:77/258 - (29%)
Similarity:112/258 - (43%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IYNGVEAKFDFWTFLASVWVSGY-------------HECGGAVIDSRIVLTAAQCVKNKPVKRIT 70
            |:|||.|:|..:.::|::   ||             ..||.::|.||.:||||.|::.:||   .
Mosquito   123 IFNGVAAQFGEFPYMAAL---GYGAPNGTEAGLPSLFRCGASLISSRFLLTAAHCLRERPV---F 181

  Fly    71 VRVGTPDIYRGGRI-----IRVTALVVHENYK--NWDNDIALLWLEKPVLS--VRVTKIPLATK- 125
            .|:|..::.....:     |.:.....|.:|.  .:.||||||.|.:||..  ..|..:.|.|. 
Mosquito   182 ARLGVLELQPARTVDEPLDIAIRQATPHPDYHAVTYQNDIALLELAEPVTGDWPFVEPVCLYTNA 246

  Fly   126 -----EPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELV----EPVG--EELLC 179
                 |....:..|..|||.:.........:|......:..|..||..:.    .|.|  ...||
Mosquito   247 TGGGLEALAGQPLSVQGWGTQQPGDTEPAARLMKANVSLVERDACAASIPRTRRNPTGLHPGQLC 311

  Fly   180 AF------YTENDICPGDYGGPLVL----ANKVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIE 232
            |.      .|..|.||||.||||.|    .:.:|||...|:.|| :.:|.:||.|..||:|:|
Mosquito   312 ALGRNEQNETVADTCPGDSGGPLALNVDGRHYLVGITSSGYSCG-SPIPGIYTEVARYLDWVE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 77/258 (30%)
Tryp_SPc 19..231 CDD:214473 75/255 (29%)
CLIPC10XP_310506.4 CLIP 45..89 CDD:197829
Tryp_SPc 122..372 CDD:214473 75/255 (29%)
Tryp_SPc 123..375 CDD:238113 77/258 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.