DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and Pi15

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:195 Identity:50/195 - (25%)
Similarity:75/195 - (38%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 APIPKTHERPPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTI-----NAALNKLAQEWAN 66
            |.|||.       |.:.....|::.  .:.:..|:.|.....||..:     :..|.|.|:.|| 
Mouse    62 ADIPKA-------RRKRYISQNDMI--AILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWA- 116

  Fly    67 HLRDQNTMAHRPNPKY-----GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQ---------- 116
                 .|......|.|     |:|:.:..|...:....|:.||.|:..|.|...|          
Mouse   117 -----ATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRC 176

  Fly   117 FVPTAGHFTQLIWKSSVEMG------------SGVARKADRTWVVCNYNPPGNVVG--LFKDNVP 167
            |.|...|:||::|.:|..:|            ..|.|:|  .::||||.|.||.:|  .:|..||
Mouse   177 FGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRA--VYLVCNYAPKGNWIGEAPYKVGVP 239

  Fly   168  167
            Mouse   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 39/158 (25%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 36/150 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.