DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and PRY2

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:54/149 - (36%)
Similarity:80/149 - (53%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TKGNNELFLKEVFNTTNKYRAMH-GCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIF 87
            |:.::..|...:.|..|..||:| ...::|.:..|...||.:|:.......:.|...| ||||:.
Yeast   185 TQSSSSDFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGP-YGENLA 248

  Fly    88 LSGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTW---VV 149
            |  |...||.  |:.||.||.|||::...|..:||||||::||.:.|:|.|: :.....|   ::
Yeast   249 L--GYGTTGS--VDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGL-KSCGGEWGDYII 308

  Fly   150 CNYNPPGNVVGLFKDNVPP 168
            |:|...|||:|.|.|||.|
Yeast   309 CSYKAAGNVIGEFADNVMP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 45/130 (35%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 47/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I1908
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H116686
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm46540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.