DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and PRY1

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:55/142 - (38%)
Similarity:80/142 - (56%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FLKEVFNTTNKYRAMH-GCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDV 94
            |...|....||.||:| ..||::.:..|...||::|::.....|:.|...| ||||:.|  |.| 
Yeast   162 FASSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGP-YGENLAL--GYD- 222

  Fly    95 TGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTW---VVCNYNPPG 156
             |...|:.||.||::|||:...|....|||||::|||:.::|.|: :.....|   |:|:|:|.|
Yeast   223 -GPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGI-KTCGGAWGDYVICSYDPAG 285

  Fly   157 NVVGLFKDNVPP 168
            |..|.:.|||.|
Yeast   286 NYEGEYADNVEP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 49/130 (38%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 49/128 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I1908
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H116686
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm46540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
TreeFam 1 0.960 - -
1211.800

Return to query results.
Submit another query.