DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4270 and CDC25

DIOPT Version :9

Sequence 1:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_013413.1 Gene:CDC25 / 851019 SGDID:S000004301 Length:1589 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:18/77 - (23%)
Similarity:30/77 - (38%) Gaps:13/77 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 INSYDFN-------KAQFVPT-AGHFTQLIWKSSVEMGSGVA-----RKADRTWVVCNYNPPGNV 158
            :.:||||       .:|.:.. .|....::.|:|.....|:.     .|.:|.|...|:..|...
Yeast    64 VAAYDFNYPIKKDSSSQLLSVQQGETIYILNKNSSGWWDGLVIDDSNGKVNRGWFPQNFGRPLRD 128

  Fly   159 VGLFKDNVPPKQ 170
            ..|.|.:.|.|:
Yeast   129 SHLRKHSHPMKK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 14/63 (22%)
CDC25NP_013413.1 SH3_Sdc25 62..122 CDD:212816 12/57 (21%)
RasGEFN 1117..1246 CDD:214571
RasGEF 1301..1543 CDD:214539
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2621
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.